PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10008135m
Common NameCICLE_v10008135mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family WRKY
Protein Properties Length: 486aa    MW: 53138.1 Da    PI: 6.4137
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10008135mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY78.66.8e-25174230259
                      --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
             WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                      +DgynWrKYGqK+vk+ + +rsYY+Ct+++C++kk +e+s++ ++v+ei+++g H h+
  Ciclev10008135m 174 SDGYNWRKYGQKQVKSPKGSRSYYKCTYSDCCAKK-IECSDHSGHVIEIVNKGMHSHD 230
                      8********************************98.*********************7 PP

2WRKY98.73.8e-31348404359
                      -SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
             WRKY   3 DgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                      Dgy+WrKYGqK+vkg+++pr+YYrCtsagCpv+k++e++ +++++v+itY+g H+h+
  Ciclev10008135m 348 DGYRWRKYGQKMVKGNPNPRNYYRCTSAGCPVRKHIETAVDNTSAVIITYKGVHDHD 404
                      9*******************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.3E-19167232IPR003657WRKY domain
SuperFamilySSF1182902.75E-19170232IPR003657WRKY domain
SMARTSM007747.7E-23173231IPR003657WRKY domain
PROSITE profilePS5081116.926174232IPR003657WRKY domain
PfamPF031064.1E-16175229IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.2E-31331406IPR003657WRKY domain
PROSITE profilePS5081131.927341406IPR003657WRKY domain
SuperFamilySSF1182906.67E-27342406IPR003657WRKY domain
SMARTSM007742.5E-35346405IPR003657WRKY domain
PfamPF031061.8E-23348403IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 486 aa     Download sequence    Send to blast
MAESESFEAR KRHENPQNDE FEEEEEEEDE EILDDEEEDE GASQLTEPHQ LQLTENNKHH  60
KGLQVNSGVE SNEGTKLKEQ VEVSQHEGSG SIAVQAAESQ TQYQLQPSIC PTSLSELSPT  120
SVTEPISSAP SPTLTGQNLS LVKVDTASVP EANLQNSSEL KNVSVVHIVK TPVSDGYNWR  180
KYGQKQVKSP KGSRSYYKCT YSDCCAKKIE CSDHSGHVIE IVNKGMHSHD PPRKNNCVRE  240
SRLISSVGPV IGNNITEQSL RMLNDSVPST SSKDSVRDSN LVPERKRPNL SSFAGDGEVS  300
VKEEHPSEPE PKRRVKKDNL ANSSPLLKPG KKPKFVVHAA GDVGISGDGY RWRKYGQKMV  360
KGNPNPRNYY RCTSAGCPVR KHIETAVDNT SAVIITYKGV HDHDMPVPKK RHGPPSAPLV  420
AAAAPASMNN LQLKKTDAVQ NQTTSTQWSV RTEGELAGAA MDLGGEKAME SARTLLSIGF  480
EIKPC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A8e-26334406274WRKY transcription factor 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX2360330.0JX236033.1 Citrus trifoliata WRKY2 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006453624.10.0hypothetical protein CICLE_v10008135mg
SwissprotP595831e-146WRK32_ARATH; Probable WRKY transcription factor 32
TrEMBLV4WJB70.0V4WJB7_9R
STRINGVIT_11s0037g00150.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63382844
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G30935.11e-133WRKY DNA-binding protein 32